ELF(P4T44 (444ԀԀ؉؉T7$$$/system/bin/linker,Z>a?pDN`MxC^RY!yI X8jV r7KsPe ]im9o'T4# v5f~Sq[=")&%:3A<H+FG; W B_\.$Lg*EQ2k/-luwdOc{hbUJ10}z6@|n(tPH\Hhth (6,;  ț ԛNpz +d0y*A TOlK o ((4I!@oLVX9dOpP |t#@V0*@$  ,/I]PĜ}Мܜ<y}l, @"$9HI0M}$B<HT(`lxV UP5̝؝'l=yHNlKZl p,8(+D P<Ih.\^ht,.c8iHK8tLId(ȞԞ dATPKH\~&1(j4,@(IL#Xq [d~XKPIpp|&]`r lK$dH0$`ğL`KПܟw\iUQ |$T08,lK<MHT `Wl\x4 0/",hKN̠$Fؠ^i5q4 F,$y8|Dlibc.solibstdc++.solibm.so__libc_init__aeabi_unwind_cpp_pr0__errnomemsetselect__aeabi_d2iz__aeabi_i2d__aeabi_dsub__aeabi_dmul__aeabi_dcmpeqrecvabortgetpeernamegetsockname__stack_chk_fail__stack_chk_guardacceptsocketsetsockoptbindlistenstrcmpconnectstrlenstrcpymemcpyrename__aeabi_unwind_cpp_pr1strpbrkfputsfwrite__swbufunlinkfopenfclosefputc__aeabi_dcmpltmemchrsscanfmemcmpstrncmpstrcasecmpstrchrqsort__aeabi_daddstrncasecmpstrrchrstrncpystrtollstrtoklocaltimemktimestrstrfgetcatoifflushfnmatchlstatsymlinkreadlinkchmodoptindgetenvoptargopterr__sFoptoptgetopt_long__aeabi_uidivmod__aeabi_ddivgetaddrinfoinet_ntopfreeaddrinfogai_strerrorsetlocalestrptimestrcatfreadmemmovememrchr__aeabi_d2lzexitgetuidgetpwuidfilenoisattyvsnprintfvfprintfbsd_signalputcharfstatperror__aeabi_l2d__aeabi_idivmod__aeabi_dcmpgt__aeabi_dcmpge__aeabi_ldivmodclock_gettimeclock_getres__aeabi_uidivstrspnnanosleeplongjmpgetpidsrand48drand48lrand48ioctlmunmapmmapfgetsfdopenfseekoftellomkdirutimeforksetsidfreopenstrftimevasprintfsetjmpsetitimerfreestrdupreallocmalloccalloc__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end___stackversion_string_sch_istable__getopt_initializedexec_namedownloaded_html_sethash_pointerfnmatch_nocasenetrc_listdl_url_file_mapoutput_stream_sch_tolowertotal_downloaded_bytesftp_last_respline_sch_toupperprogress_handle_sigwinchtotal_download_timeoutput_stream_regular &0&$+(,,80:4M8P<V@\D]H_LePhTqXr\t`udzh|lptx $(, 0 4 8 < @DHLPTX\`dh l!p"t#x$|%(*-./01345679;<=>Ĕ?Ȕ@̔AДBԔCؔDܔEFGHIJKLNQRS TUWXY Z$[(\,^0`4a8b<c@dDfHgLiPjTkXl\m`odphqlspvtwxx|y|~ĕȕ̕Еԕؕܕ -Ə/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌxƏ/ʌpƏ/ʌhƏ/ʌ`Ə/ʌXƏ/ʌPƏ/ʌHƏ/ʌ@Ə/ʌ8Ə/ʌ0Ə/ʌ(Ə/ʌ Ə/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌxƏ/ʌpƏ/ʌhƏ/ʌ`Ə/ʌXƏ/ʌPƏ/ʌHƏ/ʌ@Ə/ʌ8Ə/ʌ0Ə/ʌ(Ə/ʌ Ə/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌxƏ/ʌpƏ/ʌhƏ/ʌ`Ə/ʌXƏ/ʌPƏ/ʌHƏ/ʌ@Ə/ʌ8Ə/ʌ0Ə/ʌ(Ə/ʌ Ə/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌxƏ/ʌpƏ/ʌhƏ/ʌ`Ə/ʌXƏ/ʌPƏ/ʌHƏ/ʌ@Ə/ʌ8Ə/ʌ0Ə/ʌ(Ə/ʌ Ə/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌƏ/ʌ  0Wc؉ @-{>QvN @0TpP \0$d0nT3n.T 0 ,:C>C[/t 0C2!<0T0`D .R,?"c@3c B:b= XQs\ `0@^PS \P]P P 40 Q/ePoP/qP/H8@-@`PM@pP 6PP 00S 3/7᭘X 000ЍP]80 QUad-h-8t`0` @-0@P 6 P 00S 3/P @ d-@-Mp@ 2 `0ÌP 0`PPЍC-MP` @2  0!p  p@@00Z 0 4 L0`刀 0PP0S Ѝ耄.AA-4MB`p6  P  0 K 0P V 0Q 0 p001/@T  Ѝ 0p@TWn0 08O-PAP1p@M`PPأ (!0 S8 !  60 p 0 0U % 0P@0  1S 6s_%l8,tE-`ࠟ` 0 MLp 0P  0P @  0@!R  0 QЍ@n002_D8S<S "S S 0S &S0S| `R@( P@ 0BSUA.    R00p&  0 <Sg0l00t0@0 &00;00 00p 20C@ 0&00K000o 0@ 0C4 B0 &000C0002 0@ 0A-PP@P` pP 1P 0P 1PT 1@絓 K200(0 00x-l-@0@ 0@-0@MPP Ѝ0@1($$0-  0D<%@-@pP@ MP t0`P  00P 1JH Ѝ{1x1Pp-D0@-@MP8 P ,0 1)'Ѝ0D@-P`pPM@P 0PP R1`72P ЍP@ Ѝ@13101Hp-DO-rR`p MPr @Pp  00P . @3PD R 0S R0S? R= R0S9 01P 1尒宒9P@ὒ S1 P 0/P P宒@᫒ A1 Ѝ0剒凒0S0 /S 0p/S DP000S p-Du -4a4LM` @p0(0 TP# 00 c@ PP, ὍP 0( Q& KP00 c@~` @<0 K[R0Xut-uu p-LQLaL MP0<@  PB 0  b=3Q 0 1A%Q ?Q! #Q Q000  Q Kp %002  00 02    T %003  !00ezu8G-p`0'W"W  "p C@P@PAR 90p0P@T * 0#S &S  @T0Z@ C@R 0p0R d00Z@ C@R 0R W 0R W  -PLMP p`08 00 /@ `ALA 0 08 0 0R(K,u -䇟'LTM0t 0 %i7\ @P .PX \it 00 Q(K100 c0h0 ZX R0`0 V@'@7l p0 ` d d0h l0 3/@P; p 0!RY @80PT0 D @@TY 0P006 /`P 00p0 1S p Y0`00p0 1S 4Yp 0!R$d0X 0Sd0 \hˉ0` Y YY` T ` o  YI Yl YT 0 SRP ᵌP  p 0!R P |P P@  T0@QTP0`D0 H0 p 0!RPU Q`0S  d@00@S* ,40@ r@00P0 0p@}@ 0`@p 0!RD00D0  0SR p @R@ /R0 pS 0@< T0 p/T@pT0<80 ~80!WL L0./ \ 80L <L0p@,@ 0@p 0!RvL嵏᳏H00H0 bi0lPI@ ጋH D0X @ 09@~ @ 00@0 X0S h0 X Z D H p 0!R (rX00c c@00 <ⓏL 0~0W0 NX 0L CXhP 0 0Rv>B 0CP0 0<\0X T ,4PL|0P,0:0Ѝ $ (0H`Q00 ! 00C00!A!R `xHt' 0@P  Xu 0@P, V+ @ p`pX  g@1S``X 0 $  $`0N 0$0#$0:^% (9 0!RBlP P ,01S(0 0$0'  (`H(` `$``0  (0N 0(0#(0 qa0"S 0' @1S /wPG1S `0,GZl, 0b 0cP 00h R P Pq`1SlP@Q PR Q xG?P   0 rS00wQsRxR  ! P0| 1Sb G]#0h0  1SC ~G?|h 0!R8 sG4P0h0 1S, hgG(0SP(~00@h 0P0` `@`~ lV' h R+ Rl< A0@So  P@0!KlP0@!Dx&@P4 1~0 1S`00M l@0P!,l A0/S0p1SE P@G!lR|0I A0*SI P@0! lP0!|FlP@F!lPFD|F< 0 , 0 F1p1S lP@ FP@F!l00 p1S P@F!l\\}d}d8~}x~}}T~\~T}|}l}}<~~~d~}}tD~~\{~O-{MPpQ FЍ;`PI @0@D TP8U y`P 'P$+' R}0t1Sp;@SP LP ʟ$@P FPd6P x@.PP 0! T@PS @0KRÿc$0 PP0D0d0H L@TXDP\P`P1SK PPPP 0S  <S* @p@I@ np@P G 0i/ QG0㈠S1 8 ( }80Pp @ |8PeP0 _yP |0ZyP |0UyP |00<00MyPV P\ hȟ\(  0P@ @1S0S;S   0S;S;S;0C0P`EPE}|t @1S c0SR 0p'm 0@'pP 0P1SED7`d@P 1SO,Y@P gP0P P U @GP 40!R7;@P (0S:SS 0S:SSP 0S:SSP 06@a 0P4vn@@b `F,0( PP0D0d0DHL T@X`\P`P1S  P= P7 P` @ ,0F+SPMNMLKJIHGFEDCBA@?>=<;:98A543210/.-,+*2('&%P`V0P 1S`\] <0(0{<P@ p o8 @ T:djăԃ܃\ -ttoLM p(@,)K0  0hKl K` h@ l Eh0S h0 l0S{ l0 0 d !U0P0  P@ `. 0  *4ϟ 0S AT$=d ?$ PP P P%0!R  0] ?@n ?  u x@ 0S HK P H0S S $\3 h 0 P@u`dp P \)00h}== 0 j? 0!Rl $0PS ,v 0E*S^jY00   V`p0@I\* T 90S T" K00 @00 0 )K P0RT \u D 0 PU 0% _d0 !R 0  0(  *0S t0S1S 0Sh0S  PU kT X@@ 0 K'K )K V0iKp|K p@X`t!KYW9p@ Pd 0 R 0 vg @0 >00P`00 Q(K  |0S}p0Sl0 z90v x0Sll0Sh0 i80e@ Ph`@)0 !R/P8 \ 8 \/ 00 P ڬ` 0R/S 0R@ B/SPP@P  `` t/00; @1S\4 `AT PP - PqP&45>"`1>@P@(>P,=jPP>H>00ZU 4UAx>\>@=$=l=K=@=`K P `0Sg S P! d@K PP- 0E2S  V6 Te` _; N=A0:S65`0 AT )KPP  P1S  90S$ 8004d2'PP P`ATU=VPP. P P}0Sm  PP# @P PPH " Pf0P`(= 'PpP tK  $PP 0E*SKyIHGFEDCA@?>=<;:98765432W/.-,+*)('&%$#"!<l<d%01So0 < k< <L< {<<t<<@< @1St xP EP: 00 &:PPPP}< N: =<D00 0P dKvP8i\|T4Lvlĉ,d Ԅć4lTD,dLTԈ| 8\t$t,Ć1S, 7,P d 7@>/ @M)P8s7N8X TԊ4DO-0P000M \`@`k찟pBn 0!R- p P0@ 0 0!R-n000Ѝ<P X J7D E7 7FT8DdO-0M00 p,cP` Ѝ#  <0S Q@& 0S 3kPP@ @TPU @0/S P P 5 6@PU$0S) [? 0L RX ,2PQ@zT $ 5/pM P @@4 6@QW   0O0 p1 Rʊ0S3[ 0L R+ ,1PQ@(T $5/P @ @@0Sq~0P$@4P 0{6-R0P0S 0 00C[$$o4< ^6E84X<PdE-$@Mph ltx| rPRp`0hU9 S,U  @ T@ T pp +P lP 00lЍp1 Q @ T@000@/PM_P  mP@쀟1S 90S hP lP \ P@ lPsZP 0S h0S T 5  Pd 0 5B8, -ll2LMPQ<0 08 00 } @"0@ 0 (20 R3< 00 Qn(K^ 0S PU0 10 RT  p`@@0S00 c0!S /S0S T0  @ @1S: ^@P c3 R5@ 00  ~8  000)l @ X 8  Xl@ 00S0SH0 H41S 4 04?8XŤL\ -(w(L$7Mpǟ P0 0 @ t0 ` ^1S0N 000 Q(K0  000    S    £  Q_ P 0  $60 R3 00C 00S $ k 9X IY 1S @T  THl^  TR 0s Rs Q 0S0S 0]!ROk XHk 0X 0 P0U0 0S  r 0R   00C 0jQ  @3P  P00T 0  0e R0F2 54@ 0e R0S KPk @ @+20 4  #p d F4@ p 0Xh2( 3렀 @ _ 0!Rs 3 m@F hP 0hPy 2 Q0O ti KKP0KLSS K 0\=RpbH 3@ ( 3 *@#0: S00 c! !  X@ Py @10 3렀 0@0 0 R ` 3@00 R 0\! 0 3 @ P0S  X3D R3@ 1S t$3d 3 O(=8-X<\lԎtt\4,0, 0 0 0 /#EgܺvT2  00  0 0/O-0M 0Q@00   00 [ o* H@0 L@ 00#   P0) @ 0@0#tɟ $@ $ ` 0!0T 0#08ǀ(0(@0 0 X@0# 0*%Dn,0,@0,?*B0Q B\@0#  , 0.0` 0#pa0"00#dp  0ȟ000@0! 0h@0#$0dlŀ404@0 0 l@(0#.D]#Bp0,(B0 ,0# b*8 0.)H0OA 0#80Gt000"0<80#W@ @@<0dEx040!0@<0#@ǟ|80 D0D 0$00# T<0lʀ00 0 0#.0,R#0m'0#  @b%0" 00#0!00# 8@Ɵ 0 00#@lɀ0,00#, Fn 0.@0 0#@@M'0$Q- 0 0#  D+0"00# ($a0!00#4Ɵ`0 00#D@̀0,00#$@% 0. 0 0#  0Eb)0"@ 00#@@@dF0$P00# PP 0]<1CA0%0A0#@<0!0,@0#n)D`.k.B0 B0#8@ Tğ00`` P P0  Db.0#Nʂ0"A 0#APeX0,0# 0%tD( 0#n0!@0# @%%G@K*BJ0.J.B<0#  b(0$0#ğ@0 0"0#l΀0  0#S$0P0,0#PPeX 0!C40#< @0%0# @@dN0.0#"L](B 0$ ,BXß0#  b(0 0#8Ă000#sa0xG0ipG 0#D@ppg{ 000#,"0 0<@ 0#Ÿ %0 00#$l͂000#Ha0.H0H 0#@L舁 000#0,B0@0 @0#@0dMࣤ&C+B00.B0#  b+00ů0#@ꨂ000#(0 08 0#l͎ 000#d ` 00 0#4@ @! 0 0 0# 0 @ 00@%@ ^@  ЍxjVp $ν*ƇGF0Fؘi\"kqCyb%@@QZ^&Ƕ]/ց!7Ç ZEL*og"amqD꾤Kp~('09eVD")#9Y[e ]O~oN~S5:*ӆG-@pT`@VV  `?@ &?`0dQ1! ~0@@T 00`j ?P  ?@  k@A-0`P0V00t007Vxpf8pf@ S ! 0 1> 0 A )0/0S S/S/0S/O- 0 M   00 P` pUV@fgTPP`P` 0^0 UV 00f 0 ЍT 0^0 p`(-0-O-ȭ͟ PDM@ T 0c m0 Rbx-x 0 p-l=@0@P=0-S +S P ,=@ 000SF 0SC  R  0 1-Q lPx P@p @\0`S 000:WP|< Q `< RJ X 0 L@lS qSf 0@0Ppf 0S څPS 0S a]!  0S څPS 0S K]!0 pGVs*0W0 @l#S aSPWA #00 9 W #00 0pS0oS0sSW0;S'VW T#00 0uS0oS0tSW0;S"90mS0pSW0;SP&*\@4@0 0P?\@) 0@ 0P\@0@ 0Pv\@0@ 0PUW .^00 W0S^   W0;S~  W&00W 00 0tSW0;S>|P0   0   @P0@<0 7A^00 W0ST` -p删LMpP @0(0  @a00 cQ ap01)P 0( Q$KO-ʟM Q 0 tD"x"  ? Q< `T@  <@1,018!<@ `4AP V!PK /P(@p) @!0@]S  =P R( >P& /P$ @V81SS0P-S0P-SP\     -\ -\-\-\I !0L]S  =\ R >\/\ 0L5SVSRPONMLKJIHGFEDCBA@?=K;:98F654320/.-,+*)('&%$#"!-P`v](\ >Pq  P,d$ p0 @- pV!0L]S  =\ RP >\/\M 4I 00P-S VA0-S >SJ0P-SGTP5 0-S >S>K./P >P Lp!0@]S  =P R# >P! /P L00VL0pV 0 @>P ,P @V K0,PL W 0@  V!0@]S  =P R/P >P =P V  0@0K  VxL 0p48p<@ ,0S`L PZ $ ^DuHHDQH Pk 0S H0 Z $ @0K_C$41L 004104 0@08 <HD0b$ 0 "'P"P V*@ P S R@0 @V>R Vp2804@@<>Pc  V0 @  V0 @>P \L 048<@zH$ ,(0R1!, ,0 $00,1\00 @E$ !(A03/VH@Y P׾ Pj$O-MU$rPpr "0 !Rw0@T0# 0%B*   d+P``VQ00 @3 00 @, PP  U P0P QH@ YPI@P# Y VY 0@S V@: T Ѝ0VF0 @ P *0|0 @C| 0"XD 5H0 !Q !~8dtL0@-< <0@ PM0 Ѝ0-O-DM@ TbP` "P 1ST@r0,@@ $0T< 8 ( 4 0 d0`"P @\$0\ P@1S} (R400P jX OT8DЍQ 0 1 2"@ T  0`0S Q @Q0@\0S n\0PQ @z P QP Y!   @ P 0 @T0 P@D0 @  Tykx0 .! GP L !^< 4 {D8-.D"|tL|E-MpX `P@PU P@ZPЍO-M`  AqPpP7 Fܱ@ 1SIGPP= W 0!RF W 0 0!!Y0P0`0  0000S Ѝ0/S 000PU @1S-Y tGPP1S)1SgW  0@i d t 0 X  V D  P 0  J 8L$E-pbPl` M GP@ AP 49pP. T 1 P Ѝ,PP $P00 0,S P@b  e௼P0P00,Sl P \ 00@p @0N 0';^0 @ 0 @0 UR0 RR0 LR0=S00 @ 00 @ 0 P  p@  0 006@ltly`p@-P@MP` P 0 `P l @P TP000Ѝp0~P 0 00̔0@-P0@L0 MP kP 0 P000 Ѝ0$ܔO-L1LM 0` 0PD 0@  0 SP6 Y0+ 0@ p W"@ PU 0 @S "PP  09P  0000 00U PЍp@-0@0MP `P  0P 000   P UP  EЍpU`p@-P@`HP@0#"P 00  0 0p0@-S@ S S U@U@Up@-`P U 0S P@P 0 @SP {Up@xU 0 P/0 @N8G-@RbPp@ 0 @^@@P 0 @=P P 0 @=Q Q Q 0@S 0 @W P =P  0S@@0 @ 0 @"P% 0S0S W\ 0\0 @ 0P0 @ @^0S) 0 S"S 0S"SS  0 @ 0 @P WW 0SWhE-4M`A@qP 0 ,000 00000 0$0(0P 0 @\ G\ -\+\00 PU@ 4Ѝ0MS0TSC@ԕA-lpl0p 1SXX0P`P@ᑻWT@PPPPWh8 NNܕ -@Pa L M@00 cୁ0a p00 嵹qi40 W0 0R(K -"2L,M H0 0@ < L 0 嫺@娺 @ Zp`P瞺0@嚺`@@ V P00 cD L区@L Dm`D  ppPP@ `@0`p X 0 pS8 $ `P` c@ DP:0 0 pPU@ 6 0 0 0p S@ 0`  00`1S8T@ @D<V0賻@P @H00 Q (K<@0< =@0 D0 8LO-PLaMU`@ 0Ѝ0pS TZ 0qZp @ 0d\ 0:S  P ^*p@0 ^ 00 @J ^*0Z0 @ 080 - M00  Ѝ0@- MP@ 0P T Ѝ0 0@D0bT@ z00O-RMp" `VP @U @ PP4Ѝ R 0 0 p SSЍOR 0  R ` -`ؐL M` 0p :0 MP @g00 cQq !0x1 @ 0@ 00 @R 0 00 Q(K> -`0LM`p0(0 @ @00 cQQ0 ĸp @?C100 cAA J8 Q( 0R$KtVUUU|0Pp@-0P@`$ 0dS0ECP%*Q \ \ \@p0 S@ \ @p0R 3P 0 S@- M 0P M Ѝ -LM∔ğ t K  K  K 0  0 0 00 0 ,0aP) 0嬀@!`h 0Pp^P @T ! 0PpSP P@M ,07PP 0\S  R^Q P QPP0 0 Q(K0S  `@b `  @pKaKP炀K      ݷ ~w{  v r0壠KPķ i e  a] V尷p 笷`稷P奷 @P 0?Q 0 PR0Sa ᅷ@Ⴗl c ¶w"0 0 KPPHꏶNN N~ԖO-ġ`  pS0M 2 0 QRߍ= p02 1SIW7HW ,T @V0`P 0 `Vp!R)W 0!R VV 0!R \"0} VVhqX  jH0a 84, -OoLMΟ@P4B @," D "! \Hb 0 $ ( 02 !  0S;  ( 0 ("00( $qP00  `ZP1 BSz ,>4b@0Q $"P 2(b@4B@ 0,0.( 54bH 0 !RB 0Sg4"42 - 0$B$b0(,@SK.KL PA L1SW PAL1 T] LaPA V T $"(0S  $ @9$"P:`^4<P$0T@@ CO42 0AT 4H@81SH1S 42\,  04bH @HPs 'NK 0 KGO42 04BHb0Q Q@ 4H"0 @Q$   02S 4BHbP Q 4L 0 V0  Q  ";4b@  R ˟ 0L S 2SG P4HPHAT 1ST!@V0>P0\ t:4 42h@,BX0,``4b8%1Pg 4"HB0!RSO0 @SpF pP `U 0SPPUOp1@0S S S0 S S vP@k@0(,PQ  p n0 S0S څQQPNp01WD 0U 0dS 4H0!RsZ 4"|0"(D0S  (H0S 42Hb(@0H0!R I0Ss 4bH 0@T !.K1SDBt D84!@0WP( `h4 0@ PS\ D4"L 0\ 4LppcN4"H2LBa0  0\P ` 4pR_K <$P HP  >0PQ !RL L74b R~ <ǟ 0L S J " 4BLb0 \ 0yL1Sv P1Ss (v"VK` UK42`2p@` XaT1PfU 4ԕ P U l4"X 00 @U 42 PU Ɵ4X 0 0 @ 00 c@Aa ?01P$8$p40 L0P!BS DS b4B WPXşX  0 @P|4"4h 24BDb00 QN(KLa0V0  V 1SG42ଳP- aV90@20#0 P < 4BPT @V0mP ? ^&" 0@ 0#2 4P" 0*nP >K`P W`p42SQ  R R@ P B4b0 @R{ RR P BQ*R 0p42Ђ 0$4B ਲP ŸX  0 @ @A P $(0S L`b z[`R_K <PT >@ cp@P UH!K0IDJP/ 4H*0STt0S&1S# 0S h0S(DK(@DT L("D@@L 04H L1SF 004Q@~$7~8D\\dl,)`\}.\Ԛ\{T$` B0``PRKP ,`\ 4 Ph,``4H11S 2S - (0Sl Q Hx=4B RV,^PEPR*4"X0U 0 @IL4H`K &PZ xPP @$T >4 0 :(4L \>4 R l> R   4bH(()1SeĎ4 0   Un4Xb 0 4X"0   U ;PzHAF4bh sh (2 P ( 0S ?4"04b \ ^0 >4 R > 2R$ wBT :H"KR ( P4,>,.0  ݭPgC1[4:S``X 0 @ 4"XB0 @P S-V?KUKT" `2 T!XQPb00 c@A a|01$T-4B0 `Ǿ T24`B 0@rpp1SA 4" ;l.P\*4BXb0 0  4X0 0  \h̟H[`X 4X 0 0NK >K0X42@P p!1 $?00@K  0NK -^c0 ] `p@X4bP `1!0@ *Q X"400 !.K>K P!>K!NKnK0#42 bG(B(  "4B0* kf4l4d <4P q 44"8 .4"$ (!K OP4Bv(b,00 !K^`` F`94 R=0&o(".DpP/ 42`P Pɟ4@ P }G(4"@2D W*0S t0S1S 0Sh0S ,"` ``@ X8 2RL&-(bDDP lx0(4 D` (DDP 042( OP,``7b R",0S|/ !K(  0 4Hp0S ^ lF,`0( Q ("(B0 aVu64 R匭'4 0pW7 4"HB0 R (bD 0-S 4k4H0!R (2 0  ͬ 0 ᪬ (FB0t 0(` AU00(`0R 0#!K (!K 0(B08` @(PaV X54 R H5 R )4 0 R=(0s^ '\NE44B( R 4b Ri44B0v,```PB(q? !>K`p>W'u>|4b @ \1!.K=!>K@c> 44B0Q  42  V:4B,`"r0S 34 ^*!nK=4| 240PgE(8D,姪-GA(BD~( 0 2 R'!(BR0 0 P !K iPH24B R 2b R 0S\24 bvT(D34H@ 1S ("D$(2 0 ,*0S t0S1S 0Sh0S% (4D/pW(D@ZL4x0 04 R$O(B4b8Dp(DBpP{90S(24BD  X0 R .<0 RE&0b R=N N\{lNtu |< ԛLtLԃ܃d\\lvtO-nΟM` R( L ,pH"$ ܝ 0hP 0-S ~D(, @008!R ]0S  <Q M0S 0 R*0` 0吪 0phP ZD2BP8 90 SD8PDd10S0D0 1S 04@ k#tfC 0p9 R 00S 0 RD\k 0^e 0t R 8PXæA" $@ QXN 0 RH  $0 P<.CpP C, 0E4Szr;:EnIsr4ponmlkjihgfedcM$K_^ [ZYXWVN44QPOMLKJBAG >d1Sr e1ADPDj *0SP hPMX  0p@P0C(0@0S  @Ҩ0  U@ P _CP [CP WCP SCP OCP KC 0 Qߍ .XP$GO ᛩ 0P^ -Cd1S8 05P  A 0" P∩P`0: S& X1 0P @q# *3".C; RY 0Spq 0hP~ 7 Q@ 40S P 0S@A4-C"DKC; $4 0|7".<@*à N 奨 ">"΍ $0HC;0 ^ PUB r1 :*3C;".@: <0@ 08" 00Sp Xn)@,@ &,0S@!h  "@y 0 RP   0}?CS 0r L Sʫ 0HS0LS O00ꀕ 0 ~ 0!R P p@ 044D R09 0!R" !R 0@S| 1\*3C;"@t 4C;"΍T i: F { 01 90S P 0 |k 00080bLPD0% P?:0".@::<0 P@ "΍@,:0".P': 0P # 1"΍@01  0  > ;HRP:H<0  0K! >-P  (PU]Z0Ss(0v 2Ġ!@Lˠ !"> 0  㶭s9X<0 8 '@T 09 R" U5 *  U"@ QA"@ @p@i '@w| 0d UX] u ,P(Q 00 J @d9<0 @> 4".C;@V9 0. l) yȟ8NNL\\<Ԝtl |Lܞ=S=Ѝ0O-q圱Mp 0P XPT RP0S+ R) ,ţ`PJ @eT* T< T-( 9P  1P  )P RP0S 0 Y XPT!Ѝ P 0 0PX Pp`ꠂ8\l|L HTA-M@]Q`PP%  T *L T*0\0 @ T !\0g0C SVMF : 0  Ѝu`v T* @ T; 00 @L T*0\0 @ T   P 0 0P 0 BtL`vAtL`vqL` vAtL` v @DT@-PMp@nT `P  ᢡЍ00000 P~ H@-PMp@KT `P  Ѝ00000 Pܡ~ Hp@-PM@ l `P `0PP ;;Ѝp40440 @嵡}8 H@-PA MU`p@, :U 0 @  0 @0:SS:S Q00S KP t0tt 0`{ ЍH0@6P,0@*7| H<8@-@MT` |7pP @T P@T  P D0/S/0C0P7Ѝ6@0@-@MTP @S7 7Ѝ06@A-p@p0p@`P1S P0 2, ( 0  03z8\@-M 0@p P d0dd0 㘡  P ;;Ѝ⊡8z Ht -L0 M `0Pp(0 剡 `A-0A001 P ( 0R K]될y-P0PM0?P Ѝ:TPЍPxA-`PP@` :0 R 0~S :0p/SP 6P 0R/S 0R B/S0P0B0/S0/S  09x0N|@-@P@ T *0P@/S 0p/S0T0:G-(c(3M`@Z/ᛠ P0 p0 8Qp(PPPQPP廟P B6+0 2 + 20p,(1XPPQXPPPTQ@P 0S|R@P: D9P:U1 8P+ OP 0 0@6pP;  0PD7 A1 @cU10 0ǟ9Ѝ`X1` 0@帟P 9P 99 6pP@ p X L  uP0p00 P@凟7P 9PPH0HX 0t8w8 @\}0N H<d440 R/ 0P/00/s@N f0B" A0S S:   0S R:0P0 sU 004`K4 0@P 0`p* 4p p 02 0+$QE)|@%00 ۛL}H=@0; R *n0o 0A0C 0 { 0+000@ 0v< R  1P Q cba`_n|; 040 Vd d 040 L 040 G ;P Qq 040 ;: 040 1: 040 % 0  R040 x h ~@ @ vp< ( nPp @廙 㩙 ങ0  V?Q 9P00 S4 90yS. oS ,0 nR  &  * D9p)pPPi0 21RS  R!0 S0 0 0s00#0S 0S0Q *0S0 ^1S _1SP@ p`h0S 1S W21S0SQP@*0SW04 RW 0@ 0S0S100 cW @P0"P_ 0@ T000!P0 @0 01ShP 0-S 0t Rj <74'@P 7K{P0: Sy ᇙPW F | y6 t0Sm P0@K8K< KP"@01S,<P j38P f30SS 0@0<0  80 R21S :"P= @d`3"Pdd 0V0d0@01S 811P 1S08 c8IP 哘@\ V 50500x T0☙㡙P P@4P 8@ K@0S4 -@0S 90S  0  d B42@Pdğ 0 ! +5 6`0KKṘc$ϠP0CXlUb#.0Ea#c0a<0bT\ @ 0@  0X0 @P0 0SV+ @@1S 1S 01S W@@v2T Y00 Q(K0{20Sh21SeWc40S  0  `21S0SX 0! oN1 A,[1Vh#0PF h Y㴘Q 0 P 僘qd1P  0Se0 0T00t@! 4 01v0Ssk0@  PWE qe n#_n,[ԧ|dD|LLT80LLh4DHXlE.ų4l̃vTt _, įtlܭ K*@P 唖`P @T Rd Xb0S PU[XT P0 0`O40S X3T3TT 0P-X `PX B0h4@TD S0XP P74@804@T% 1040ST20S 0\pTu q@X11KP DP =P 6P P1Ph 0`嫕PPb4/8@8  T4 @ 0 @4@S40 8@  0 `d000 R0d0 @ P0l0 0n8R8n@Tܧ HD0 0/Ko0 0/K op@-$$M `A0 Ѝp\K o@- @(K o0 9KohL@-H@P ^ (0 0 JnnA-:Pʕd`Ppe` T0@ +0P@H0 T᫕p\J,E-`@PM`& :㤕P pd#  PP 00U P PT0T ZP0S 3/Ѝ虔$0@upI, oo$C-t@tP@MQ`p P0 R 00<  0 @ЍIoo o,p@-@P@U` P 0 0Q |0 R ph0  \p@PP V 0ؔP lH4<8o,HD@-QQ M@P& 1!`0T& cT@%]=/0T*h1TB`1T4X1$P1n|D1 t`<0,q a( B(n1 `0Tpp  Ѝ/p<0"b l0刔0p B(a}\T0tn 0a<0pD c%nG\{,ՃųE.old$L|\O-DMB@PBhP!P$e(0倔` 0 R 0CƟbX0W 4<0&(1 Y8|@P 0oOcPl@  <X@H Q] ͓ 0U"V3`[0PP0@ +00 R@ 0? 0>eP P   =0R00@C>000fXf0A X @]00$0 ˓4 aP 0Q0^?Ӡ 0 FP =` 0 Ȓ`@Tv@UС[P1 7+PL (\ qW  ($$$4ΒP$Ty!ϒ@P r 0’!4B$6C@P P$56 듓A>@p<@ Z㖓`0D O0ZP  d `$< 0a0bS a 00<0 `0cS 00DЍ G_1P@  70 00@0@ R]00 @( (EGz?,LX@= ףp#@p@-`,@,P@nkp@=C-@pU M`p!Q 0$DI$+ ЍC+PT=O-鐢؀YM@P 0 S52 b ḑ  0 "2WP@=1 7⢑Pna0S@!ᛑ!1AP T $ $|$!ЍR AP%PP00 ,P-00Q@ 0A 0c$+@$001S 015 6!0^0A 0#[눁-`-`Vp!#>-@`!M0 0@PS 0@ $A 00 00zXxq01V/0v 0 <333333?o?oE-` MpP@r+W 0 (% @ 0S) `0S n%PP00&000@ 0cA+$_ 0$ ЍVD@0 0SH%PP0`0 ,P-00$:oo\0@-|Q@PMP 0S `PL1 >2 0(!,1Ѝ01 AT ʐP ĐP 0 >0 >C(!,1೐P 0>0 F?C(!,1t࢐P P0> F?C(!,144 Ѝ0@S98HO-DM@Π!`(ȟF, BP @ 4$P*$F0 `. hpPW  ?؀ WiB" ߐ0`P "%< 0 "2@PPt"t2P`2< 00P  1AWBP "PP!ᦏ @PPG 0ᗏ!4B$6C@P኏PUDЍ1 7Տ@P 5 6ᶏ`]@h P @$? Q ._@P"P  ``1 Y8Y@P 0 L, 0@_C_4 Qg "@@TP`5 6h0< h78X@= ףp#@4DL,O-PP$M !> Ӡ(az X* (1Sa(1S @,Q(1S!O$ЍO0)! j! ??p#K@P$E l!( I0x38dTO-ı,M P>(`@ ?ae"a00Y0Tdqp  @,埏Q8  Q000(!S200iY0;Z  $,0`  ??p#K@P$E !  @ ,fQ`000!<00iY0,ЍO28T~TdO-`$M(p@P(Б@ K Π (! P @_@B A,PP!%P?`Vpa `p+ $ Zq@j`j  0Z  0P@,QP!$Ѝ@ ??# ! %+A5`pP@@q 000 0K08Td\\{/ 0 0/.,o, ,0@- @Q 0! -(o'A-MN(`0p`@T PP ኍP0崀@@P 0勍 0Ἅ 0QP h h0 Ѝ;-D ( (0 @-$o(o,oeAMbP?A- 0M ` `ƍp@P` h0K 0|!z @P:P !p@P@Ѝ,(oeAA-@`PT`p 0 S000 0 !0R0C0a'8 c1S  [+8O-tttp @PM` Q8"P 90S 0!RЍ 1PS$' 0!R P= 0S 0 UP @0S @H0S P $0S0 #P 0s) 0CS%21S"$?$P 0!R $ 0!R 0Sd0S1S 2P @0S` ڌP 1S L 0 R 0S 0!Rx u@P] P 0!Ri8#"] 0!RX D0Sz}Pp 哌Pk 0Rg21S 0a P\1S4   kz1S+  bq1S" [jV Q P @ ;&  8\@H7*8\d4<\{G-pP @X&0嘀 000 @@Q !`PR0S`0`S`8  1S  %84O-TMH@P(  0& ($ض% 0 ( $R!00840 N0 0 040 d60 RM Q O D@ <0#Py 6@P DP08@0D >O0Sp 40 S P Ri 000S8Z XDy%80D0X < Rr 21S R  0Q  1SA4P @0!R 90S 1SR8 09 R444 x4^P44ڑD=%@P 9%4Py 5% 040~ H40 Rx  P 8 %40S %44 C4)P s 7DF% 41SO0S 3 P 4k P < R|0 4DN0@ 0p R N0S)Wx D`PDw (0St h,P  Z(0  $< sP1PU,QiND<@p ` $$ (0`PS@$T 0!Ra!PM0!20$@$<0   0_0$ $D p$($ 0O RTЍ0S4 , l0 R30S3K$H|0 qR 0D 00!90S 0x 6 `D0%P0H)D%8XDT\4D(TO-q MPpn 0S0j@\e [  Y%^0 \U\X ^O %\\1P 0  `0   @U2P1 7 B"P@V00F 0 7 B 00/S@%^0P 0  `0   @U2P0 7 B"P@V00F X0 7 B 00/S\ 0Y Ѝ`0@-0MPS@0#0@SP |#Ѝ0@x#0@-<0<M0@P@i#Ѝ0G-@@M0P p9`9  0 pWp `V`@9`p?#T P 9#TЍP8 -p娀L Mp `P0(0 @ `1Q ᙈ:0080P K0( Q Kt4o -qLMp 0` P耟0 卉@ `1Q f:00P 8 K40KP 4P @ 8| 00 Q (K@" nx4o@-QM@`p*0/S P R S0000" 0!0CP`pЍO-@M "Lt Tp| 0000 0  dsP X:d@T5  P0@#P, X ^ 0^0 @ 0#S^0^N0 @ T*0|0 @P 0-P@\: X@\- \p p!0Sp Qh"`PV@ 0S01 @ ^ "Ppp Ѝ Sځ,"00\ *0 @ 0 @ \Y\*:PPU+*0PU&*00 @``V: d R R. R`~P\  U00 000z`fPr\0S 0Si 00cQP]\  0 eR R 00 G0*S0000/P  @-MpTP@PP `GЍΆ0 `lp@-`0P`@0S P KPPPU 0S =P |@+@AP03P PpPU8PUpP8P :0  8X4DA-@P`p 0P9ὄ 01 6 @PP00A4 6P 005 6@PA4 6P 005 6@P5 6ك@P00>4 6΃@P@-M 0`p tPPP\ \0PL0 H@0D@ YЍX@= ףp#@,A,Qt`v 0LPaIH 00^0H < d ] 0    O PY*8Yn00fd d0%@P a80`p<8ffffff?PsT?@@,T-\075O-6ƟlM00 0I0 d`V`Pb A+  p W8 0&`FC1qo V `VU,`@V ,@1 7À@T-@P) 0 0᳀P@ᎁ` 05 6P`V`hpV %?AcV$?AcVL4 B` 0c000 P X RpXh04 CP X4 B` 0c000P0P0U0S`\ U 0  U P00U0UP0 h S4BU400S$ 00S$P$$ , 0h b0b0CP0Cp?(00c(0( Q"2Q 0S`(\(@  00@T`(0@  0tHX`,\ $U@@UWwW  00pW`( R @pP 0  @0T` 0d QwlЍ0M AP` (@`  0@T`( R 0  ` ,0h0l0C^0Cp\pA$pE$Uz 0kP!1P A1 7 0@PP`@-A@A0  .0nT` @  0td$PE`Ur0  Y(`N(E $ 'jgfff?O-BŸ5?32. VS 00dT d0Yrn l*0 rr @0L*0 jr`p,*0cr0*0\r`p)0Ur)00Nr`p)0Gr)00@?r`p)08r)00@89X~d L)0 )r @0,)0 !r`p )0r0(0r`p(0 r(008XZ<0Y>: >(0 q @0>d(0 q`pD(0q0((0q`p(0q(00q`p'0q'00@v7XI7X7YOڀ7Yʈ $)Bl7 q @0$)BH7 q`pA%Z<)0qA%0Z<)0qp>0`&q&>00q`p&0q&00@{q`pp&0tqd&00@+ A%Z<)0 gq @0A%Z<)0 ]qp>`0%Uq>0%0Mq`p%0Fq%00[49CX~d 0 8q `0 d 00q@P 0)q0 0"q0  /0 q `0 /0q@Pd 0 q0d 0q@P 0p0 0p`00  ', 0 p `0',  0p@P/0p0/0p@Pd 0p0d 0p@P 0p`0a+*.0 p `0a+ *.0p@',P 0p',0 0p@P/0p0/0p@Pd 0p`0=) -0 |p @0=)  -0sp`a+p*.0kpa+0*.0cp`',p 0[p0"0 Tp @0!0 Lp`=)p -0Dp=)0 -00`X oP >00@\Ᶎ?Bɚ; vH TrN?z xEc#~rNvH Tʚ;4v8CXD0YC> ]$(X0 o @0]$(|0 o`o$p(0oo$0(0o`$p)B0o$0)B0o`pA%Z<)0oA%Z<)00@3'7CX$'h1 o @0$'1 zo`]$p(1ro]$0(1jo`o$p(1boo$0( 2Zo`$p)B(2Ro@0$)BL2Io`pA%Z<)0@o@0A%Z<)06op>`0".o@0>"0%o`p"0o@0 #0o`p$#0o@0D#0o`p\#0o@0|#0n`p#0n@0#0n`p#0n@0#0n`p$0n@0$$0n`=)p -0n@0=) -0n`a+p*.0n@0a+*.0n`',p 0n@0', 0n`p/0n@0/0n`pd 0n@0d 0zn`p 0sn@0 0kn@00  X@-XPXpX0P@0 2&0 M00@0/B@a@Ѝ般VUUUA-0XC P@`P!*8qP0#! 002!" 001!# 0@\?0  P  ?CaQ Q "100!0" 0P0!=0 00h0H0#!= 00"0 Ph0%VUUUE-\QM@P CU`5X 00 {m5 6l1 7p`l P@ PP@00 UЍX ?# A5P %+U@`  T3 00@4 @ 0 P*ꘪeܳ|A- M0p`lP@P@Q!1lP& 0lP 0lP& 0lP @  @  Ѝl@t  L@0 0 4@@  fffff#@ff?MbP?Mb@?pO-M@@ 0SP:ЍରDD 0 @  Q00 T03SW p0` k@ WZ`@D啗)J$ p@-l@PP@ `0`"iPpDiP 0Spip3p 8i0A-pPPp1 `@ 0L R  P P! RPX0L R hP ii0L PPp80@-M@IiPP P 0/S 0p/S  R0/S 0P<P @0S  PЍ00@d0P<P@P   @ p3 }p8@-`M/p2h@P h@gP g/00gЍЍ@am/@- @h4PT 0@fh0ؖxvP0Pp@-0mh`P@P  h.h@_rhp茖\}-lM hP0: SlЍ-lM hlЍ -؀ؠLM @0(0 h `1qBg0/S@@0S/SPP P`s`3P V /00@hV 0( Q$Kg̕ -鸀帠LM P`0p(0 Yh'00 c!@Q 5g .00@ 0 `0pP 0( Q$KWgܔ0@-MP@PU Ѝ0Ѝ0@Ѝ0@A-p`@ f0S s@!PP X@e@-lM `cg@pP@0: S PlЍ\0 Q bgPP ff00 oF@80@-P Mg f8@p@ Ѝ0ff0 Lx @-pPMp 0Q @>gP#g0P`@P @gT g Ѝ@|g0 pP Bg@`tftgL>fTlg0005f(8Htܧx$L@-M0#@ g<P 0 0@ 2gP Ѝuf 0 0ꠐ-G-M8<Z3 Cg`p @P@pU`@ 6gVPp@U@p `P  f0P`@@V 0W@pg@P00ЍGЍ/-- M0 0 gP ЍЍ/e0 Sfp@- M 0 0fAP@ 3/ Ѝp/fe0P 'f000f@Kf 0&f 0efTP00P @e 3/e@` @@@@eexe`P[D.Afp@-PM8@`,0@(0 `wf먍 t0@-M@f40PP0 Ѝ0@@wfXp@-PPP`P e@T p[e@Tp 0@-MPLe(0@P0 Ѝ0ꠌ0@-MPwe(0@P0 Ѝ0P;Zx0N<[y1OClosed fd %d conaddr is: %s Accepted client at socket %d. Local socket fd %d bound. binding to address %s using port %i. Connecting to %s|%s|:%d... Connecting to %s:%d... Failed setting IPV6_V6ONLY: %s%s: unable to resolve bind address `%s'; disabling bind. connected. Created socket %d. failed: %s. %s: unable to resolve host address `%s' /index.htmlorig.origCannot back up %s as %s: %s ?#%%d; URL=%sApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d Converted %d files in %s seconds. Saving cookies to %s. wCannot open cookies file `%s': %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. :%dFALSETRUE %s %s %s %.0f %s %s Error writing to `%s': %s Error closing `%s': %s Done saving cookies. Deleted old cookie (to be replaced.) (ANY)permanentsessionsecureinsecurenone Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s %lfdomainpathexpiresmax-ageSyntax error in Set-Cookie: %s at position %d. cdm: 1 2 3 4 5 6 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s Discarded old cookie. .com.edu.net.org.gov.mil.inttype= Detected newlines in %s "%s"; changing to %s "%s" PASS--> %s --> PASS Turtle Power! --> %s SIZEPWD"SYSTVMSUNIXWINDOWS_NTWINDOWS2000MACOSOS/400LIST -aLISTRETRRESTCWDTYPE12EPSVrespline is %s LPSVlpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d PASV|%d|%s|%d|EPRT%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dLPRT%d,%d,%d,%d,%d,%dPORTUSER331 s/key 331 opiekey rbtotalPLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; size: %s; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %s bytes file name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,confusing VMS permissions, skipping line wrong VMS permissons! permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. @ ���Index of /%s on %s:%d��� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
JanFebMarAprMayJunJulAugSepOctNovDecJANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECwrote `%s' to STORE byteLength: %s (%s), %s (%s) remaining, %s remaining (unauthoritative) anonymous-wget@Logging in as %s ... Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... ==> EPSV ... ==> LPSV ... Cannot initiate PASV transfer. Cannot parse PASV response. trying to connect to %s port %d couldn't connect to %s port %d: %s ==> PORT ... ==> EPRT ... ==> LPRT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %s ... REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. Lying FTP server found, adjusting. accept: %s ab%s has sprung into existence. %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. File `%s' already there; not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%s] %s URL: %s [%s] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. Removed `%s'. Rejecting `%s'. ../Error matching %s against %s: %s No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%s]. Wrote HTML-ized index to `%s'. %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Recursion depth %d exceeded max. depth %d. Remote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %s) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[mReleasing 0x%0*lx (new refcount %d). Deleting unused 0x%0*lx. Found %s in host_name_addresses_map (%p) Resolving %s... , , ...Caching %s => %sfailed: No IPv4/IPv6 addresses for host. Loaded %s (size %s). %s: Invalid URL %s: %s no-follow in %s: %d %s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. namehttp-equivrefreshcontentrobotsnofollowhrefrelstylesheetshortcut iconactionappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletdthcodesrcbackgroundlowsrcdata0123456789abcdefCDisabling further reuse of socket %d. %s%s HTTP/1.0 ---request begin--- %s---request end--- Failed writing HTTP request: %s. %s:%sBasic HTTPDigest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="Skipping %s bytes of body: [EOF received] aborting (%s). %.*s] done. HEADGETPOSTRefererPragmano-cachebytes=%s-Wget/%sUser-AgentAccept*/*Auth-without-challenge set, sending Basic credentials. Found `%s' in basic_authed_hosts. Host `%s' has not issued a general basic challenge. AuthorizationHostConnectionKeep-AliveCookieContent-Typeapplication/x-www-form-urlencodedPOST data file `%s' missing: %s Content-LengthProxy-AuthorizationReusing fd %d. [POST data: %s] [writing POST file %s ... done] Proxy%s request sent, awaiting response... No data received. Read error (%s) in headers. ---response begin--- %s---response end--- No headers, assuming HTTP/0.9%2d %s Content-DispositionfilenameFile `%s' already there; not retrieving. Registered socket %d for persistent reuse. BasicDigestWWW-AuthenticateNTLMInserted `%s' into basic_authed_hosts Authorization failed. Malformed status line(no description)LocationLast-ModifiedSet-CookieContent-Rangebytesunspecified [following]Location: %s%s text/htmlapplication/xhtml+xml.htm.html.%d.html The file is already fully retrieved; nothing to do. Length: ignored [%s] STDOUTSaving to: `%s' Reusing existing connection to %s:%d. Unknown authentication scheme. Warning: wildcards not supported in HTTP. Spider mode enabled. Check if remote file exists. --%s-- %s %s --%s-- %s Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: Remote file does not exist -- broken link!!! %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists. %s (%s) - `%s' saved [%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] %s URL:%s [%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %T[%s][%s]:%drealmopaquenonce%s: %s: Invalid boolean `%s'; use `on' or `off'. %s: %s: Invalid time period `%s' %s: %s: Invalid number `%s'. %s: %s: Invalid value `%s'. infunixwindowslowercaseuppercasenocontrol%s: %s: Invalid restriction `%s', use [unix|windows],[lowercase|uppercase],[nocontrol]. %s: %s: Invalid byte value `%s' %s: %s: Invalid progress type `%s'. %s: %s: Invalid header `%s'. Setting %s (%s) to %s %s: Invalid --execute command `%s' HOMEno_proxyWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrc%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Syntax error in %s at line %d. %s: Unknown command `%s' in %s at line %d. acceptaddhostdiralwaysrestauthnochallengebackupconvertedbackupsbindaddresscacheconnecttimeoutcontentdispositioncontinueconvertlinkscookiescutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpuserglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsproxyhttpuserignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlykeepsessioncookieslimitrateloadcookieslogfileloginmaxredirectmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdpasswordpostdatapostfilepreferfamilypreservepermissionsprogressprotocoldirectoriesproxypasswdproxypasswordproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedsavecookiessaveheadersserverresponsespanhostsspiderstrictcommentstimestampingtriesuseproxyuseruseragentverbosewaitwaitretryIPv4IPv60123456789ABCDEF%s: %s: %s wget-log %s received, redirecting output to `%s'. %s received. %s: %s; disabling logging. Usage: %s [OPTION]... [URL]... GNU Wget %s Copyright (C) 2008 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Currently maintained by Micah Cowan . GNU Wget %s, a non-interactive network retriever. SIGHUPSIGUSR1WTF?!Try `%s --help' for more options. 0%s: illegal option -- `-n%c' Can't be verbose and quiet at the same time.Can't timestamp and not clobber old files at the same time.Cannot specify both --inet4-only and --inet6-only.Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. %s: missing URL DEBUG output created by Wget %s on %s. eabiRemoving file due to --delete-after in main(): No URLs found in %s. %dd %dh %dm %ds%dh %dm %ds%ssFINISHED --%s-- Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! append-outputauth-no-challengebackup-convertedbind-addresscacertificatecadirectorycertificatecertificatetypecheckcertificateclobberconnect-timeoutconvert-linkscontent-dispositioncut-dirsdelete-afterdirectory-prefixdns-cachedns-timeoutdont-remove-listingdot-styleegd-fileegdfileexclude-directoriesexclude-domainsexecutefollow-ftpfollow-tagsforce-directoriesforce-htmlftp-passwordftp-userhelphost-directorieshtml-extensionhttp-keep-alivehttp-passwdhttp-passwordhttp-userignore-caseignore-lengthignore-tagsinclude-directoriesinet4-onlyinet6-onlyinput-filekeep-session-cookieslevellimit-rateload-cookiesmax-redirectnono-clobberno-parentoutput-documentoutput-filepage-requisitesparentpassive-ftppost-datapost-fileprefer-familypreserve-permissionsprivatekeyprivatekeytypeprotocol-directoriesproxyproxy__compatproxy-passwdproxy-passwordproxy-userrandom-filerandomfilerandom-waitread-timeoutrelativeremove-listingrestrict-file-namesretr-symlinksretry-connrefusedsave-cookiessave-headerssecureprotocolserver-responsespan-hostsstrict-commentsuser-agentversionMandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. --no-proxy explicitly turn off proxy. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. --ignore-case ignore case when matching files/directories. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. --protocol-directories use protocol name in directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data. -E, --html-extension save HTML documents with `.html' extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --max-redirect maximum redirections allowed per page. --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-cookies don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --auth-no-challenge Send Basic HTTP authentication information without first waiting for the server's challenge. FTP options: --ftp-user=USER set ftp user to USER. --ftp-password=PASS set ftp password to PASS. --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. --no-passive-ftp disable the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dir). --preserve-permissions preserve remote file permissions. Recursive download: -r, --recursive specify recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML point to local files. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . .netrcmacdefaccountdefaultmachine%s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name bardotTERMforceemacs%dm%s%ds%dh%s%dm%dd%s%dh%dd%2d%% 100% %4.*f%s --.-K/s in binarymegagigaInvalid dot style specification `%s'; leaving unchanged. %3d%% %4.*f%c=%s=%ss %6sK %*s[ skipping %sK ]B/sK/sM/sG/s eta %s KMGCannot get REALTIME clock frequency: %s Dequeuing %s at depth %d Queue count %d, maxcount %d. Deciding whether to enqueue "%s". download_child_p: parent->url is: `%s' Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. Enqueuing %s at depth %d Already downloaded "%s", reusing it from "%s". Redirection "%s" failed the test. Not descending further; at depth %d, max. %d. --delete-after--spiderrecursive rejection criteriaRemoving file due to %s in recursive_retrieve(): Removing %s since it should be rejected. /robots.txtLoading robots.txt; please ignore errors. wgetallowdisallowCannot open %s: %shttp_proxyftp_proxy%s.%dsleep_between_retrievals: avg=%f,sleep=%f Giving up. Retrying. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. %d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): %.*f %sdeferring a %.2f ms sleep (%s/%.2f). sleeping %.2f ms for %s bytes, adjust %.2f ms KB/sMB/sGB/sCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~(null)Found no broken links. Found %d broken link. Found %d broken links. *password*%2E%2Eindex.htmlRemoving %s because of directory danger! %s: %s:/0123456789ftp://%shttp://%s@/?#;httphttp://ftp://No errorUnsupported schemeInvalid host nameBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address%.*f%c%.0f%.1f%.1g%.3fhtmlhtmUnlinking %s (symlink). Failed to unlink symlink `%s': %s utime(%s): %s forkContinuing in background, pid %d. Output will be written to `%s'. /dev/null%Y-%m-%d %H:%M:%S%H:%M:%S>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/KMGTPE1.11.4%s: %s: Failed to allocate %ld bytes; memory exhausted. strdupreallocmalloccalloc@P (08@HPX`hpx (08@(x(p(((()())()) ) ) ( ) ) ) )))))))@5P5`5p55555 5p>x>p `0JJJJKHK`KKKL`LLL(MhMM`MNPNNNXOOO`PPP(QpQQQ@RRR(SpSSTHTTT8UUVXV`VVV@WWWX``XpXXX(YxYYZPZZZ [`[[\@\\\ ]p]]X^`_(_`___(`p```a a`aabXbbbHc`ccdhddeXeee@fffg``gxiiiixiooottttu uHuhu8J8J8TJ8EK)I8J8J| (J8K8rJ9J9DK(9TJ89JH9KP9J| X9J`9Kp9 JL998J9J0F0J9K9K| 9 K| 9J9$J$:4J:DJ(:K`;?K@)JXp;$K;J;KX;JX;XJ;I| ;;`J; J;I;J<I, <HJX <K0<bJ@<\JH<PJX<(Kh<,KXx<x <=K<JX< J<J<J<J<I=J@=J=J(=I, 8=H=JP= JX=Ih=Jx=L=EJ=I(J= KX=J=J=I=J>J >I, (>qJ8>LJ@>pP>PX>J`>J  ؉!D  <\$<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?XH,(,(,(),),),), )Ȭ (), 0), 8), @), H),P)X)X`),h),p),x),),),8A8DaD8)b)DK888(B(D8DD88EE E8E@E9(9c(9PEk89`E9H9H9xEP9X9dX9E`9PG9EPp9E9E90FD0FEE9EFFX9(F:8Fe@F:PF(:`Fx9xFF8:FX:Fx:::::Fh-F8FE:::F:F:F:G:G;(G;8G(;HGI8;`G4P;pG6`;Gi@)Gp;Gl(=G;G;G;;m;GnG;G;HO<Ho;(Hp <8H@H0<H<H<PHX<`Hh<pHx<H<HH<<H<H(>HY(>H<H<I<<q<=Q=I(I8I=HI=8=r8=H=H=P=RP=XILX=hIh=xIx=I=I=I=I=IIS=IH===J>HETHE>N> >t >8>8>JU@>P>vP>P>P>(JV-X>wX>`>`>0hcat`Z(hYV4VK:/ttP HHt pyGCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1GCC: (GNU) 4.2.1Aaeabi.symtab.strtab.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.text.rodata.preinit_array.init_array.fini_array.ctors.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributesԀ#)  1DD9 \\B <<F<<KPP!fQqY؉ht, $$x*0,1<,1Rp~338U R#Ph؉    4 hУ(lLTФD R_4n8$8}<@P`DHx4xXlded .L4Դ6|LT\dplt|x\d8d@d4@T`|\нlDTdTlxl4$0p`Bh0hMaTo( (zH4H||(D8D||$Xp(ppp||Dlx<D t x# 5|0PPAL0"M0YD#\D##'an q'H'~(X(t(t(\)l)@l)***0:X;8E8ELLTLNNNVxQQTTTVV]@^t^^^hij8k4#@ @kHkLkPkTk4Tk$k kl-:lhzFO_zz{{|d|hl|8l|t|`||}(}(}8}8}T}T}p}}l}}8% }~~,8܂8% `t ؃ ؃,88T8@4)D$DhЈK܈TT<<e  r0HPHtpD8XXԫȬdȬ$',`,50E8d8OH^hk$qLt<Dx PhdhĹ̹(̹l ``LL46@@R00k 0 ~PP ܋ /̋($H '<3PDPD\WpXg`H`xX( ( T( t | | d x x  , d,   t  ld pp 8% LLB $0U @@c Hm XX ,  $$ P 4DP XX@ 4 LhL $ L$ `  D @p   E   8. K lP H !^ Hh $!$!"} <##(## h #|$ $$0&h&& F&&  &&) )H)H*\***++,8 ,,,- --- --<.! + P.xP...p>B P \ i p w  \?  @ @ @@\AH PHhH pHH HHHHHI  ItI   i  IJ 0JJ0 JlKD KKHLS hLhLNf p y XNXNU ԍ ULU,V 4V4VV VVY  Y<YZ ZZd\ \\D` i t`pt`a aac cceԍeee 0f4f5 ,HO̝V؝[De mdv# l0L4@k @h D#N*3lK?`LNl] lzp $,8(PDP<f<Ih@f 8\^t h"7